SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011063 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011063
Domain Number 1 Region: 266-385
Classification Level Classification E-value
Superfamily POZ domain 1.18e-28
Family BTB/POZ domain 0.00049
Further Details:      
 
Domain Number 2 Region: 635-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000875
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011063   Gene: ENSMMUG00000008438   Transcript: ENSMMUT00000011797
Sequence length 773
Comment pep:known_by_projection chromosome:MMUL_1:8:82912998:82949925:1 gene:ENSMMUG00000008438 transcript:ENSMMUT00000011797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASAGAVAGAAEEAKELLLPQDAGGPTSLGGGGAGGPLLAERNRRTLAFRGGGGGGGLGNN
GSSRGRPETSAWPLRHFNGRGPATVDLELDALEGKELMQDGASLSDSTEDEEEGASLGDG
SGAEGGSCSSSRRSGGDGGDEVEGSGLGAGEGETVQHFPLARPKSLMQKLQCSFQTSWLK
DFPWLRYSKDTGLMSCGWCQKTPADGGSVDLPQVGHDELSRGTRNYKKTLLLRHHVSTEH
KLHEANAQESEIPSEEGYCDFNSRPNENSYCYQLLRQLNEQRKKGILCDVSIVVSGKIFK
AHKNILVAGSRFFKTLYCFSNKESPNQNNTTHLDIAAVQGFSVILDFLYSGNLVLTSQNA
IEVMTVASYLQMSEVVQTCRNFIKDALNISIKSEAPESVVVDYNNRKPVNRDGLSSSRDQ
KIASFWATRNLTNLASNVKVENDGCNVDEGQIENYQMNDSSWVQDGSPEMAENESEGQTK
VFIWNNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLI
KEEPDLDGALLSGPDGDRNVNANLLAEAGTSQDGGDAGTSNDFKYGLIPGASNDFKYGLL
PESWPKQETWENGKSESSLIMNKLKCPHCSYVAKYRRTLKRHLLIHTGVRSFSCDICGKL
FTRREHVKRHSLVHKKDKKYKCMVCKKIFMLAASVGIRHGSRRYGVCVDCADKSQPGGQE
GVDQGQDTEFPRDEEYEENEVGEADEELVDDGEDQNDPSRWDESGEVCMSLDD
Download sequence
Identical sequences 9544.ENSMMUP00000011063 ENSMMUP00000032065 ENSMMUP00000011063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]