SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011196 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011196
Domain Number 1 Region: 34-173
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.97e-53
Family Fibrinogen C-terminal domain-like 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011196   Gene: ENSMMUG00000008538   Transcript: ENSMMUT00000011937
Sequence length 173
Comment pep:known_by_projection scaffold:MMUL_1:1099214198293:262:2001:1 gene:ENSMMUG00000008538 transcript:ENSMMUT00000011937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPLG
PSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLT
LKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLYVAGFEDGGAG
Download sequence
Identical sequences ENSMMUP00000011196 ENSMMUP00000011196 9544.ENSMMUP00000011196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]