SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011334 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011334
Domain Number 1 Region: 97-287
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.41e-89
Family p53 DNA-binding domain-like 0.00000000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011334   Gene: ENSMMUG00000008639   Transcript: ENSMMUT00000012081
Sequence length 341
Comment pep:known chromosome:MMUL_1:16:7404260:7407511:-1 gene:ENSMMUG00000008639 transcript:ENSMMUT00000012081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDDLAQWLTEDPGP
DEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSGTAK
SVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCHQLP
PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQDQTTFQKENC
Download sequence
Identical sequences A0A2K5WMY7 F7F8L3
ENSMMUP00000011334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]