SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011363 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011363
Domain Number 1 Region: 19-107
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.15e-29
Family ECR1 N-terminal domain-like 0.00000352
Further Details:      
 
Domain Number 2 Region: 196-273
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.77e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000732
Further Details:      
 
Domain Number 3 Region: 108-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.69e-20
Family Cold shock DNA-binding domain-like 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011363   Gene: ENSMMUG00000008665   Transcript: ENSMMUT00000012112
Sequence length 275
Comment pep:known chromosome:MMUL_1:15:39632601:39637218:1 gene:ENSMMUG00000008665 transcript:ENSMMUT00000012112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPVSVAAEYLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAGERPLSLNAGAR
SRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGI
VTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVC
IDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVK
AKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Download sequence
Identical sequences A0A2K5TVI7 A0A2K6CUL4 F7F3T0
9544.ENSMMUP00000011363 NP_001244869.1.72884 XP_005581316.1.63531 XP_005581317.1.63531 XP_011731849.1.29376 XP_011731850.1.29376 XP_011731851.1.29376 XP_014972888.1.72884 XP_014972889.1.72884 XP_015292461.1.63531 ENSMMUP00000011363 ENSMMUP00000011363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]