SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011418 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011418
Domain Number 1 Region: 497-603
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-30
Family Cadherin 0.00027
Further Details:      
 
Domain Number 2 Region: 266-387
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-29
Family Cadherin 0.00073
Further Details:      
 
Domain Number 3 Region: 598-718
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-27
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 159-270
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-21
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 707-810
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-19
Family Cadherin 0.0034
Further Details:      
 
Domain Number 6 Region: 378-496
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-17
Family Cadherin 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011418
Domain Number - Region: 59-144
Classification Level Classification E-value
Superfamily Cadherin-like 0.0457
Family Cadherin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011418   Gene: ENSMMUG00000008710   Transcript: ENSMMUT00000012173
Sequence length 1235
Comment pep:known_by_projection chromosome:MMUL_1:6:138261873:138286835:-1 gene:ENSMMUG00000008710 transcript:ENSMMUT00000012173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGAGDRRCPEAALLILGPARMGPLRHSPPGGQRLLLPSMLLALLLLLAPSPGHATRVM
YKVPDEQPPNTLLGSLADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRE
CQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTN
IGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRER
WDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQV
KANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDR
GTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDR
DEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVRDYTIEIVAVDSG
NPPLSSTNSLKVQVVDINDNAPVFTQSVTEVAFPENNKPGEVIAEVTASDADSGSNAELV
YSLEPEPAAKGLFTISPETGEIQVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNV
LDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQN
GTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTS
HRLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIER
RHHGLHRLVVKVSDRGKPPRYGTALVHLYVNETLANRTLLETLLGHSLDTPLDIDIAGDP
EYERSKQRGNILFGVVAGVVAVALLIALAVLVRYCRQREAKSGYQAGKKETKDLYAPKPS
GKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQKSLKFNLMSDAPGDSPRIHLPLNYPPGS
PDLGRHYRSNSPLPSIQLQPQSPSASKKHQVVQDLPPANTFVGTGDTTSTGSEQYSDYSY
RTNPPKYPSKQLPHRRVTFSATSQAQELQDPSQHSYYDSGLEESETPSSKSSSGPRLGPL
ALPEDHYERTTPDGSIGEMEHPENDLRPLPDVAMTGTCTRECSEFGHSDTCWMPGQSSPS
RRTKSSALKLSTFVPYQDRGGQEPAGAGSPSPPEDRNTKTAPVRLLPSYSAFSHSSHDSC
KDSATLEEIPLTQTSDFPPAATPASAQTAKREIYL
Download sequence
Identical sequences ENSMMUP00000011418 9544.ENSMMUP00000011418 ENSMMUP00000011418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]