SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011420 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011420
Domain Number 1 Region: 464-570
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-31
Family Cadherin 0.00027
Further Details:      
 
Domain Number 2 Region: 233-354
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-29
Family Cadherin 0.00073
Further Details:      
 
Domain Number 3 Region: 565-685
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-28
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 674-777
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-19
Family Cadherin 0.0034
Further Details:      
 
Domain Number 5 Region: 137-237
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-18
Family Cadherin 0.0039
Further Details:      
 
Domain Number 6 Region: 345-463
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-17
Family Cadherin 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011420
Domain Number - Region: 37-122
Classification Level Classification E-value
Superfamily Cadherin-like 0.0357
Family Cadherin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011420   Gene: ENSMMUG00000008710   Transcript: ENSMMUT00000012175
Sequence length 1025
Comment pep:known_by_projection chromosome:MMUL_1:6:138271128:138277846:-1 gene:ENSMMUG00000008710 transcript:ENSMMUT00000012175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLRHSPPGGQRLLLPSMLLALLLLLAPSPGHATRVMYKVPDEQPPNTLLGSLADYGFP
DVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLV
QNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGAQE
LFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTND
NAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRN
TGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLV
THQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKK
YFLQTTTPLDYEKVRDYTIEIVAVDSGNPPLSSTNSLKVQVVDINDNAPVFTQSVTEVAF
PENNKPGEVIAEVTASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQR
DSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVT
VIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPR
SAYVGVTINVLDENDNAPYITAPSNTSHRLLTPQTRLGETVSQVAAEDFDSGVNAELIYS
IAGGNPYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNET
LANRTLLETLLGHSLDTPLDIDIAGDPEYERSKQRGNILFGVVAGVVAVALLIALAVLVR
YCRQREAKSGYQAGKKETKDLYAPKPSGKASKGNKSKGKKSKSPKPVKPVEDEDEAGLQK
SLKFNLMSDAPGDSPRIHLPLNYPPGSPDLGRHYRSNSPLPSIQLQPQSPSASKKHQVVQ
DLPPANTFVGTGDTTSTGSEQYSDYSYRTNPPKYPSKQVGQPFQLSTPQPLPHPYHGAIW
TEVWE
Download sequence
Identical sequences ENSMMUP00000011420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]