SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011624 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011624
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.02e-49
Family Fibrinogen C-terminal domain-like 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011624   Gene: ENSMMUG00000008862   Transcript: ENSMMUT00000012394
Sequence length 145
Comment pep:known_by_projection chromosome:MMUL_1:8:17746539:17750965:-1 gene:ENSMMUG00000008862 transcript:ENSMMUT00000012394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGSFHPEVQWWA
THQRMKFSTWDRDHDNYDGNCAEEDQSGWWFNRCHSANLNGLYYTGPYTAKTDNGIVWYT
WHGWWYSLKSVVMKIRPNDFIPNVI
Download sequence
Identical sequences ENSMMUP00000011624 ENSMMUP00000011624 9544.ENSMMUP00000011624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]