SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011664 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011664
Domain Number 1 Region: 502-689
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.31e-49
Family Eukaryotic proteases 0.000000137
Further Details:      
 
Domain Number 2 Region: 22-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-29
Family Spermadhesin, CUB domain 0.0000906
Further Details:      
 
Domain Number 3 Region: 191-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-27
Family Spermadhesin, CUB domain 0.0000408
Further Details:      
 
Domain Number 4 Region: 306-371
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000347
Family Complement control module/SCR domain 0.0000117
Further Details:      
 
Domain Number 5 Region: 137-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011664   Gene: ENSMMUG00000006470   Transcript: ENSMMUT00000012440
Sequence length 693
Comment pep:known_by_projection chromosome:MMUL_1:11:7289197:7370573:-1 gene:ENSMMUG00000006470 transcript:ENSMMUT00000012440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNSFETTTVITVPTGYRVKLVFQ
HFDLEPSEGCFYDYVKISADKKNLGRFCGQLGSPLGNPPGKKEFLSQGNKMLLTFHTDFS
NEENGTIMFYKGFLAYYQAVDLDECASQSESGEKDLQPQCQHLCHNYVGGYFCSCRPGYE
LQEDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPFE
IDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDFDTSSNAVDLLFFTDESGDSRGWKLR
YTTEIIKCPQPKTLDEFTVIQNLQPQYQFRDYFIATCKLGYQLIEGNQVLHSFTAVCQDD
GTWHRAMPRCKSKSIQGYDPGDFPPPALRTWAKKEASRVSLFPRDPHPDLSFDAYGPSQE
SVSPHLSRMDGLYPELNFTPPNSCPLQGPSPLTIFSKLLSSAGGQLTLPALKFQHSHSQL
SPCPVFSPSQGLWAAPKPAGAFRYTTTMGYYCHEPYYKMQTRAGSKEVSIHPDYRQDESH
NFEGDIALLELENSVTLGPNLLPICLPDNETFYDLGLMGYVSGFGVMEEKIAHDLRFVRL
PIANRKDCETWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWIATG
IVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED
Download sequence
Identical sequences ENSMMUP00000008528 9544.ENSMMUP00000011664 ENSMMUP00000011664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]