SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011669 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011669
Domain Number 1 Region: 315-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-20
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number 2 Region: 133-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000123
Family Cadherin 0.0033
Further Details:      
 
Domain Number 3 Region: 25-145
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011669   Gene: ENSMMUG00000008899   Transcript: ENSMMUT00000012445
Sequence length 956
Comment pep:known chromosome:MMUL_1:11:7436893:7464601:1 gene:ENSMMUG00000008899 transcript:ENSMMUT00000012445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLLLPLLLASLLASCSCNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLR
YAGEICGFRLHGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCGEGPDG
ANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQI
CYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAADDAEVEIQVKP
TCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKGCDRDNY
SERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPS
GLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIA
FLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALIHDNGLIH
PPRREPALMIGACWTEEKNKEKEKGDNSTDITQGDPLPIHHYFHGYLAGFSVRSGRLESR
EVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLR
FATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFARPAVDFEG
TEGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDPE
RESLLLDTTSVQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAALYARKFRL
SCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGHSLASSHR
NSMIPSAATLIIVVCVGFLVLMVVLGLVRIHSLHRRVSGAGGPPGASGDPKDPDLFWDDS
ALTIIVNPMESYQNRQACVAGAAGGQQEDEDSSDSEVADSPSSDERRIIETPPHRY
Download sequence
Identical sequences A0A2K5W1F9 F7G5B0
ENSMMUP00000011669 NP_001248071.1.72884 XP_005570061.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]