SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011684 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011684
Domain Number 1 Region: 94-327
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-42
Family Voltage-gated potassium channels 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011684   Gene: ENSMMUG00000000892   Transcript: ENSMMUT00000012460
Sequence length 841
Comment pep:known_by_projection chromosome:MMUL_1:8:134698581:135053948:-1 gene:ENSMMUG00000000892 transcript:ENSMMUT00000012460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGDAAAAGDEERKVGLAPGDVEQVTLALGAGADKDGTLLLEGGGRDEGQRRTPQGIGLLA
KTPLTRPVKRNNAKYRRIQTLIYDALERPRGWALLYHALVFLIVLGCLILAVLTTFKEYE
TVSGDWLLLLETFAIFIFGAEFALRIWAAGCCCRYKGWRGRLKFARKPLCMLDIFVLIAS
VPVVAVGNQGNVLATSLRSLRFLQILRMLRMDRRGGTWKLLGSAICAHSKELITAWYIGF
LTLILSSFLVYLVEKDVPEVDAQGEEMKEEFETYADALWWGLITLATIGYGDKTPKTWEG
RLIAATFSLIGVSFFALPAGILGSGLALKVQEQHRQKHFEKRRKPAAELIQAAWRYYATN
PNRIDLVATWRFYESVVSFPFFRQLEAASSQKLGLLDRVRLSNPRGSNTKGKLFTPLNVD
AIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSSEDAGTGDPTAEDRGYGNDFPIEDM
IPTLKAAIRAVRILQFRLYKKKFKETLRPYDVKDVIEQYSAGHLDMLSRIKYLQTRIDMI
FTPGPPSTPKHKKSQKGSAFTFPSQQSPRNEPYVARPSTSEIEDQSMMGKFVKVERQVQD
MGKKLDFLVDMHMQHMERLQVQVTEYYPTKGTSSPAEAEKKEDNRYSDLKTIICNYSETG
PPEPPYSFHQVPIDKVSPYGFFAHDPVNLPRGGPSTGKVQAAPPSSATTYAERPTVLPIL
TLLDSRVSCHSQADLQGPYSDRISPQQRRSITRDSDTPLSLMSVNHEELERSPSGFSISQ
DRDDYVFGPNGGSSWMREKRYLAEGETDTDTDPFTPSGSMPLSSTGDGISDSVWTPSNKP
I
Download sequence
Identical sequences ENSMMUP00000001191 9544.ENSMMUP00000011684 ENSMMUP00000011684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]