SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011884 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011884
Domain Number 1 Region: 148-220
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000126
Family VWC domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011884
Domain Number - Region: 231-268
Classification Level Classification E-value
Superfamily FnI-like domain 0.00994
Family VWC domain 0.07
Further Details:      
 
Domain Number - Region: 33-51
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0743
Family Cytochrome c3-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011884   Gene: ENSMMUG00000009055   Transcript: ENSMMUT00000012671
Sequence length 276
Comment pep:known chromosome:MMUL_1:14:50285182:50591267:-1 gene:ENSMMUG00000009055 transcript:ENSMMUT00000012671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSDGCAQGQHHETGRWSLPPVLWGGGIPLSSAHLRRYDCGQCHNALSVKRAADTVGRV
WLLTNVSVHLDSQEVTARKILMNVQRESLSATTIPAALTCQGGTTVSAEAVSMTMGPIHC
PGSPVLDGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGHKLYRSGDNWTHSCQ
QCRCLEGEVDCWPLTCPNLSCEYTAILEGECCPRCVSDPCLADNIAYDIRKTCLDSYGVS
RLSGSVWTMAGSPCTTCKCKNGRVCCSVDLECLQNN
Download sequence
Identical sequences ENSMMUP00000011884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]