SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011939 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011939
Domain Number 1 Region: 91-283
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.01e-70
Family T-box 0.00000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011939   Gene: ENSMMUG00000009102   Transcript: ENSMMUT00000012731
Sequence length 519
Comment pep:known_by_projection chromosome:MMUL_1:X:78806657:78816100:1 gene:ENSMMUG00000009102 transcript:ENSMMUT00000012731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSRARAFSVEALVGRPSKRKFQDPIQEEQPELQEKKGGEEEEERRSSAAGKSEPLEK
QPKTESSTTASSGCGSDSGDGNSSESLEEKDIQMELQGSELWKRFHDIGTEMIITKAGRR
MFPSVRVKVKGLDPGKQYYVAIDVVPVDSKRYRYVYHSSQWMVAGNTDHLCIIPRFYVHP
DSPCSGETWMRQIISFDRMKLTNNEMDDKGHIILQSMHKYKPRVHVIEQDSSVDLSQLQS
LPTEGVKTFSFKETEFTTVTAYQNQQITKLKIERNPFAKGFRDTGRNRGVLDGLLETYPW
RPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNLLSPPCFSPMFHLPTSSLGMPCPE
AYLHNVNLPLCCKICPTNFWQQQPLVLPAPERLASSNSSQSLAPLMMEVPMLSSLGVTNS
KSGSSEDSGDQYLQAPDSTSQMLYGLQAPGNILLPNSITQEALSCSFHPSYGFYRYNFSM
PSRLINGSNHLKVNDDSQVSFREGKCNHIHWYPAINHYL
Download sequence
Identical sequences A0A2K6AMT7 F6UJF6
XP_001102720.2.72884 XP_011710633.1.29376 ENSMMUP00000011939 9544.ENSMMUP00000011939 ENSMMUP00000040958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]