SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011954 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011954
Domain Number 1 Region: 469-617
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.19e-38
Family Toll/Interleukin receptor TIR domain 0.0000487
Further Details:      
 
Domain Number 2 Region: 122-396
Classification Level Classification E-value
Superfamily L domain-like 5.53e-38
Family Ngr ectodomain-like 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011954
Domain Number - Region: 7-157
Classification Level Classification E-value
Superfamily L domain-like 0.000556
Family Ngr ectodomain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011954   Gene: ENSMMUG00000009112   Transcript: ENSMMUT00000012747
Sequence length 626
Comment pep:known chromosome:MMUL_1:15:18364175:18374703:-1 gene:ENSMMUG00000009112 transcript:ENSMMUT00000012747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLSNLSLDLSLNPINFIQPGAFKEIRLHKLTLRSNFDDLNVMKTCIQGLAGLEVHRLVL
GEFRNERNLEEFDKSSLEGLCNLTIEEFRLTYLDYYLDNIIDLFNCLANVSSFSLVSVSI
KRVEDFSYNFRWQHLELVNCKFEQFPTLELESLKRLTFTANKGGNAFSEVDLPSLEFLDL
SRNGLSFKGCCSQSDFGTTSLKYLDLSFNDVITMSSNFLGLEKLEHLDFQHSNLKQMSQF
SVFLSLRNLIYLDISHTHTRVAFNGIFDGLLSLKVLKMAGNSFQENFLPDIFTDLKNLTF
LDLSQCQLEQLSPTAFDTLNKLQVLNMSHNNFFSLDTFPYKCLPSLQVLDYSLNHIMTSN
NQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEAERMECATPSDKQGMPV
LSLNITCQMNKTIIGVSVFSVLVVSVVAVLVYKFYFHLMLLAGCINYGRGENIYDAFVIY
SSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQH
FIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDS
VLGQHIFWRRLRKALLDGRSWNPEEQ
Download sequence
Identical sequences ENSMMUP00000011954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]