SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011966 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011966
Domain Number 1 Region: 616-952
Classification Level Classification E-value
Superfamily NHL repeat 4.18e-25
Family NHL repeat 0.001
Further Details:      
 
Domain Number 2 Region: 311-386
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000746
Family Pre-dockerin domain 0.057
Further Details:      
 
Domain Number 3 Region: 848-895,923-941,968-1081
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000212
Family YVTN repeat 0.048
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011966
Domain Number - Region: 46-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000245
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 143-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000535
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 113-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000967
Family EGF-type module 0.096
Further Details:      
 
Domain Number - Region: 185-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0014
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 14-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00238
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 79-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0709
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011966   Gene: ENSMMUG00000009116   Transcript: ENSMMUT00000012760
Sequence length 2152
Comment pep:known chromosome:MMUL_1:6:164484607:164625197:1 gene:ENSMMUG00000009116 transcript:ENSMMUT00000012760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AECDVPMNQCIDPSCGGHGSCIDGNCVCSAGYKGQHCEEVDCLDPTCSSHGVCVNGECLC
SPGWGGLNCELARVQCPDQCSGHGTYLPDTGLCSCDPNWMGPDCSVEVCSVDCGTHGVCI
GGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIGRQTAGTETGTY
CFIFINHGCPDLCNGNGRCTLGQNSWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVD
CLDPDCCLQSACQNSLLCRGSRDPLDIIQQGQTDWPAVKSFYDRIKLLAGKDSTHIIPGE
NPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGASLTLH
FERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCDLSGFVRPDPIIISSPLSTFFS
AAPGQNPIVPETQVLHEEIELPGSSVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHL
MVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEK
RTALLQGFELDPSNLGGWSLDKHHILNVKSGILHKGTGENQFLTQQPAIITSIMGNGRRR
SISCPSCNGLAEGNKLLAPVALAVGIDGSLYVGDFNYIRRIFPSRNVTSILELRNKEFHN
NNPAHKYYLAVDPVSGSLYVSDTNSRRIYRVKSLSGAKDLAGNSEVVAGTGEQCLPFDEA
RCGDGGKAIDATLMSPRGIAVDKNGLMYFVDATMIRKVDQNGIISTLLGSNDLTAVRPLS
CDSSMDVAQVRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVSIIAGRPMHCQVPGID
YSLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDCDC
KNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQ
YEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSADNDVTELIDNNGNSLKIRRDS
SGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGLLATKSDETGWTTFY
DYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVITNLSSVEASYTVVQD
QVRNSYQLCNNGTLRVMYANGMGVSFHSEPHVLAGTITPTIGRCNISLPMENGLNSIEWR
LRKEQIKGKVTIFGRKLRVHGRNLLSIDYDRNIRTEKIYDDHRKFTLRIIYDQVGRPFLW
LPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFADGKVWSYSYLDKSMV
LLLQSQRQYIFEYDSSDRLLAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDYSD
DGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVLKMVNLQSGGFSCT
IRYRKIGPLVDKQIYRFSEEGMVNARFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEI
SGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMFRSLMYWMTVQYDSM
GRVIKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSVR
LMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGSDIFEYNSKGLLTRAYNKASGWSVQYRY
DGVGRRASYKTNLGHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYDLQGHLFAMESSSG
EEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKL
VHFTQRDYDVLAGRWTSPDYTMWKNVGKEPAPFNLYMFKSNNPLSSELDLKNYVTDVKSW
LVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASENGQVSGGVQQTTERHNQAFMALEG
QVITKKLHASIREKAGHWFATTTPIIGKGIMFAIKEGRVTTGVSSIASEDSRKVASVLNN
AYYLDKMHYSIEGKDTHYFVKIGSADGDLVTLGTTIGRKVLESGVNVTVSQPTLLVNGRT
RRFTNIEFQYSTLLLSIRYGLTPDTLDEEKARVLDQARQRALGTAWAKEQQKARDGREGS
RLWTEGEKQQLLSTGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQNEMGKR
Download sequence
Identical sequences 9544.ENSMMUP00000011966 ENSMMUP00000011966 ENSMMUP00000011966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]