SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012011 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012011
Domain Number 1 Region: 7-69
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.17e-20
Family LIM domain 0.0024
Further Details:      
 
Domain Number 2 Region: 66-126
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.42e-18
Family LIM domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012011   Gene: ENSMMUG00000009159   Transcript: ENSMMUT00000012809
Sequence length 170
Comment pep:novel chromosome:MMUL_1:11:121213615:121215902:-1 gene:ENSMMUG00000009159 transcript:ENSMMUT00000012809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWH
PECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHP
EHFPTYVPTGLASTPHWSHLFLIFPQCSRRAGKGRQGLLGSLFTLISPLT
Download sequence
Identical sequences ENSMMUP00000012011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]