SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012032 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012032
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.7e-18
Family THAP domain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012032
Domain Number - Region: 153-201
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0149
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012032   Gene: ENSMMUG00000009180   Transcript: ENSMMUT00000012835
Sequence length 222
Comment pep:known chromosome:MMUL_1:5:54055018:54068349:-1 gene:ENSMMUG00000009180 transcript:ENSMMUT00000012835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDV
LCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYSH
HLVGAASCIKEFQSQFIFEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQ
KSLRKTIRELKDECLISQETANRLDAFCWECCQESIEQDYIA
Download sequence
Identical sequences H9EW65
ENSMMUP00000012032 ENSMMUP00000012032 9544.ENSMMUP00000012032 NP_001248450.1.72884 XP_014994006.1.72884 XP_014994007.1.72884 XP_014994008.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]