SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012104 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012104
Domain Number 1 Region: 1914-2053
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-32
Family Ankyrin repeat 0.000000915
Further Details:      
 
Domain Number 2 Region: 411-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000466
Family EGF-type module 0.00045
Further Details:      
 
Domain Number 3 Region: 1129-1271
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000111
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 4 Region: 369-491
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000149
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 713-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000196
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 6 Region: 588-716
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 487-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000446
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 8 Region: 815-946
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 9 Region: 750-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000106
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 562-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000373
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 11 Region: 939-1060
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 100-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000443
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 13 Region: 216-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000161
Family EGF-type module 0.016
Further Details:      
 
Domain Number 14 Region: 1105-1140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000439
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 522-566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000985
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 16 Region: 178-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 136-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 18 Region: 254-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 19 Region: 1267-1311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.014
Further Details:      
 
Domain Number 20 Region: 63-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000657
Family EGF-type module 0.026
Further Details:      
 
Domain Number 21 Region: 1448-1481
Classification Level Classification E-value
Superfamily Notch domain 0.000000111
Family Notch domain 0.0052
Further Details:      
 
Domain Number 22 Region: 291-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 23 Region: 19-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.014
Further Details:      
 
Domain Number 24 Region: 1349-1387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family EGF-type module 0.02
Further Details:      
 
Domain Number 25 Region: 1407-1439
Classification Level Classification E-value
Superfamily Notch domain 0.00000183
Family Notch domain 0.00017
Further Details:      
 
Domain Number 26 Region: 1073-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000201
Family EGF-type module 0.022
Further Details:      
 
Domain Number 27 Region: 333-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000351
Family EGF-type module 0.057
Further Details:      
 
Domain Number 28 Region: 1304-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000729
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012104
Domain Number - Region: 1487-1517
Classification Level Classification E-value
Superfamily Notch domain 0.000235
Family Notch domain 0.0056
Further Details:      
 
Domain Number - Region: 791-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0318
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012104   Gene: ENSMMUG00000017022   Transcript: ENSMMUT00000012912
Sequence length 2439
Comment pep:known chromosome:MMUL_1:15:1771558:1800248:1 gene:ENSMMUG00000017022 transcript:ENSMMUT00000012912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTSANSCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRGGMADYACSCPLGFSGPLCLTP
LDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEAS
YICHCPPSFHGPTCRQDVNECGQNPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVP
CSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNC
RCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCAS
AACFHGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCP
SGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPC
QNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFT
GHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGMHCEVDIDECDPDPCHYGSCK
DGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEIN
LDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCQDGINGFT
CRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNP
CVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPY
TGATCEVVLAPCAPSPCRNGGECRESEDYESFSCVCPTGWQGQTCEVDINECVVSPCRHG
ASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGTF
CEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDG
INSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVH
WCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVAQLCQHGGL
CVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCS
EEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNN
GTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTG
RRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGG
TCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFN
GLLCHILDYSFGGGAGRDIPPPQIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSL
NFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCKYDQYCKDHFSDG
HCDQGCSAECEWDGLDCAEHVPERLAAGTLVVVLMPPEQLRNSSFHFLRELSRVLHTNVV
FKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPEALLGQMEEELVGSIVYLEIDNRQ
CVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAF
VLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGA
LMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTPPQ
GEVDADCMDVNVRGPGTVTPAVSPQAPGGPRAGSDGHSPGELPQSFSFHDFLAQGGGAIP
PARGQGQAALQGLPTALRAQLDTVARRFCDGCRAAFVLGRRHQCTSAQHPPEPLPVAQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
VDAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRK
PSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPSVPLNHLPGMPDTHLGIGHLNVAAKPEMAALGGGSRLAFEAGPPRLSHLPVAS
GTSTVLGCSSGGAMNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAP
SLQHGMVGPLHSSLAASALSQMMSYQGLPSNAAAEPAATKHPAAAKPAAATFLGGEPSQA
DVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSSPVDNTPSH
QLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSP
Download sequence
Identical sequences ENSMMUP00000012104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]