SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012124 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012124
Domain Number 1 Region: 6-201
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.95e-75
Family T-box 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012124   Gene: ENSMMUG00000009257   Transcript: ENSMMUT00000012936
Sequence length 496
Comment pep:known_by_projection chromosome:MMUL_1:1:121796154:121903666:-1 gene:ENSMMUG00000009257 transcript:ENSMMUT00000012936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSMEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIV
PVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNEL
DDQGHIILHSMHKYQPRVHVIRKDFSSDLSPTKPVPVGDGVKTFNFPETVFTTVTAYQNQ
QITRLKIDRNPFAKGFRDSGRNRTGLEAIMETYAFWRPPVRTLTFEDFTTMQKQQGGSTG
TSPTTSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSN
MAALQSYPGLSDSGYNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYG
GQLGSFPTSQFQYVMQAGNAASSSSSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSP
RLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMHMISPSPNNQQATNTCDGRQ
YGAVPGSSSQMSVHMV
Download sequence
Identical sequences A0A2K5LR13 A0A2K5VLD3 A0A2K6KJB8 F7H8C1
ENSP00000207157 9606.ENSP00000207157 NP_689593.2.87134 NP_689593.2.92137 XP_004026485.1.27298 XP_005542232.1.63531 XP_011788450.1.43180 XP_011837561.1.47321 XP_011945338.1.92194 XP_015004627.1.72884 XP_017725325.1.44346 ENSMMUP00000012124 gi|55770860|ref|NP_689593.2| ENSP00000207157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]