SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012126 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012126
Domain Number 1 Region: 112-307
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.19e-74
Family T-box 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012126   Gene: ENSMMUG00000009257   Transcript: ENSMMUT00000012938
Sequence length 602
Comment pep:known_by_projection chromosome:MMUL_1:1:121796154:121901908:-1 gene:ENSMMUG00000009257 transcript:ENSMMUT00000012938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERRRSAVALSSRAHAFSVEALIGSNKKRKLRDWEEKGLDLSMEALSPAGPLGDTEDAA
AHGLEPHPDSEQSTGSDSEVLTERTSCSFSTHTDLASGAAGPVPAAMSSMEEIQVELQCA
DLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSS
KWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKY
QPRVHVIRKDFSSDLSPTKPVPVGDGVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAK
GFRDSGRNRTGLEAIMETYAFWRPPVRTLTFEDFTTMQKQQGGSTGTSPTTSSTGTPSPS
ASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSG
YNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYGGQLGSFPTSQFQYV
MQAGNAASSSSSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQS
TLLCSSPSNGAFGERQYLPSGMEHSMHMISPSPNNQQATNTCDGRQYGAVPGSSSQMSVH
MV
Download sequence
Identical sequences A0A2K5HJP9 A0A2K5LR15 A0A2K5VLD4 A0A2K5YJW2 A0A2K6KJA8 A0A2K6QPS5 G3RCB5 Q96SF7
ENSP00000358437 ENSMMUP00000012126 ENSP00000358437 ENSP00000358437 ENSGGOP00000013139 9544.ENSMMUP00000012126 ENSGGOP00000013139 ENSMMUP00000012126 XP_001113452.1.72884 XP_004026486.2.27298 XP_005271219.1.92137 XP_005542230.1.63531 XP_010355847.1.97406 XP_011788449.1.43180 XP_011837551.1.47321 XP_011945336.1.92194 XP_017725324.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]