SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012136 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012136
Domain Number 1 Region: 42-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.57e-35
Family SCAN domain 0.000081
Further Details:      
 
Domain Number 2 Region: 461-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 160-209
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-18
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-18
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 401-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000662
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012136   Gene: ENSMMUG00000009264   Transcript: ENSMMUT00000012948
Sequence length 517
Comment pep:known chromosome:MMUL_1:14:65064829:65082631:-1 gene:ENSMMUG00000009264 transcript:ENSMMUT00000012948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLSKLMAISKPQNMSLHEQREVLRADISWQQETIPIVETHDSEASRQKFRHFQYLKVS
RPHEALSQLWELCLQWLRPEIHTKKQIIELLVLEQFLAILPEEVRTWVNLQHPNNSKDMV
TLIEDVIEMLEGEDTPCKDSAPQMGNIKEKMKAGSRTGKPQEPVTFKDVVVEFSKEEWGQ
LDSAVKNLYRNVMLENFRNLNSLRKAYLLSKPVESLKLESKKKRWIMEKEIPRKTVFDMQ
SISGEESSHGLMITRFTGSGHPSSDVWKGENWLHRNQKKWDINLPQEAFIPETTYTEEED
FECSENKESFDINSVSSICAIQQGISSRKGSPKCDKFKTHFKFNLDSVGKQHLEYEYGND
LSLSTDIQHQKSHTTMNSYECYQCGKAFCRSSSLIRHQIIHTGEKPYKCGECGRFFNRRT
NLTKHQKLHAEAKACTSNKCGKAFSESEDSNNPTLRFGNNFYECVNCGKSFNRSSSLIRH
QMIHTGEKPFKCKECNKAFNRSSNLVKHQKLHTRVKS
Download sequence
Identical sequences G7NDZ8 G7PQU3
XP_001107571.1.72884 XP_014970502.1.72884 XP_014970503.1.72884 9544.ENSMMUP00000012136 ENSMMUP00000012136 ENSMMUP00000012136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]