SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012181 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012181
Domain Number 1 Region: 38-100
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 190-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 247-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 155-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.28e-16
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012181   Gene: ENSMMUG00000009299   Transcript: ENSMMUT00000012996
Sequence length 404
Comment pep:known chromosome:MMUL_1:19:6946050:6955158:1 gene:ENSMMUG00000009299 transcript:ENSMMUT00000012996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIILPLTAALSSPFPASQREGHTEGGGLVNELLTSWLKGLVTFEDVAVEFTQEEWALL
DPAQRTLYRDVMLENFRNVASLGTGDQVDKPGLITQLEQEDEVMTEERGILPGTCPDVEN
PFKAKGLTPKLHVFQKEQSGNMKMERNHLGAEFSECNQCFKVFSTKSSLMRHKKIHTGEK
RYDCNECGKSYSSKSYVTVHKRIHNGEKPYKCSDCGKTFSNSSYLRPHLRIHTGEKPYKC
NQCCREFRTQSIFTRHKRVHTGESHYVCNQCGKAFSTGSSLSLHYSIHTGENPYECHNCG
KTFRRSSNLTQHVRTHTGEKPYKCNECGISFTSSFSLTVHRRIHNREKSYECSDCGKAFN
VLSSVKKHRRTHSGKRPYECNYCGKFFTSNGYLSVHMRTHIRQM
Download sequence
Identical sequences ENSMMUP00000012181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]