SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012193 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012193
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily Globin-like 4.88e-55
Family Globins 0.000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012193   Gene: ENSMMUG00000023712   Transcript: ENSMMUT00000013009
Sequence length 147
Comment pep:known chromosome:MMUL_1:14:68146831:68153515:1 gene:ENSMMUG00000023712 transcript:ENSMMUT00000013009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIYFG
KEFTPEVQASWQKMVAGVASALSSRYH
Download sequence
Identical sequences G7PQY2 Q03903
XP_005578969.1.63531 ENSMMUP00000012193 ENSMMUP00000031231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]