SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012217 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012217
Domain Number 1 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 246-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 188-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 150-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 77-133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000477
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012217   Gene: ENSMMUG00000011978   Transcript: ENSMMUT00000013035
Sequence length 396
Comment pep:novel chromosome:MMUL_1:14:3404697:3407814:1 gene:ENSMMUG00000011978 transcript:ENSMMUT00000013035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHITQDFLPEQGIQDAFPKSIWRGCGNCGLDNFHWRKDWGNVDECKLQKEDYNRLKQC
SSTTHSKIFRCNKCVKFNNSSNLNRYNIIHAGQKPFKCKECGKSFQMFSFLTEHQKFTLE
KNSTKCKECGKTFNQCSHFTERENICTREKPYKCQECDKVFKTCSDLTKHKRIHTGEKPY
KCEECGKAYMQSSHLSEHRRIHTGEKPYQCEECGKVFRTCSSLSNHKRTHSEEKSYTCEE
CGNIIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPDKCEECGQ
VFMWFSDIAKHKKTHTGEKPYKCEECGKNFTQSSNLIVHKRIHTGEKPYKCEECGKAFTQ
FSHLTVHESIHTKTPEFILKDILQMHNHRVIIIAIR
Download sequence
Identical sequences ENSMMUP00000012217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]