SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012299 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012299
Domain Number 1 Region: 468-601
Classification Level Classification E-value
Superfamily TIMP-like 1.63e-37
Family Netrin-like domain (NTR/C345C module) 0.011
Further Details:      
 
Domain Number 2 Region: 285-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000151
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 341-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000725
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 4 Region: 404-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 95-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000753
Family Galactose-binding domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012299
Domain Number - Region: 155-226
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0732
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012299   Gene: ENSMMUG00000009397   Transcript: ENSMMUT00000013122
Sequence length 604
Comment pep:known_by_projection chromosome:MMUL_1:16:8773092:8992165:1 gene:ENSMMUG00000009397 transcript:ENSMMUT00000013122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRAVWEALAALAAVSCLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
GKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAYLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQ
CRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQD
WVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDD
SLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLS
GRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPISHRKACKACDCHPVGAAGKTCNQTT
GQCPCKDGVTGITCNRCAKGYQQSRSPIARRGDIPVAPPTTTASSVEEPEDCDSYCKASK
GKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSR
DIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGK
CKKA
Download sequence
Identical sequences 9544.ENSMMUP00000012299 ENSMMUP00000012299 ENSMMUP00000012299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]