SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012353 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012353
Domain Number 1 Region: 118-177
Classification Level Classification E-value
Superfamily BPTI-like 6.67e-22
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000729
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily BPTI-like 2.13e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 3 Region: 212-269
Classification Level Classification E-value
Superfamily BPTI-like 7.8e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012353   Gene: ENSMMUG00000009448   Transcript: ENSMMUT00000013182
Sequence length 304
Comment pep:known chromosome:MMUL_1:12:51105095:51154901:-1 gene:ENSMMUG00000009448 transcript:ENSMMUT00000013182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYTMKKVHALWVSICLMLNLAPAPLNADSEEDEEYTIITDTELPPLKLMHSFCAFKPDD
GPCKAIMKRFFFNIFTRQCEEFIYGGCGGNQNRFESMEECKKVCTRDNVHRIIQTALQQE
KPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNMNNFETLEECKNTCEDGLN
GFQVDNYGTQLNAVNNSQTPQSTKVPSFFEFHGPSWCLAPADRGLCRANENRFYYNSVIG
KCRPFKYSGCGGNENNFTSKRECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEVF
VKNM
Download sequence
Identical sequences I0FUM5 Q28864
NP_001181951.1.72884 ENSMMUP00000012353 9544.ENSMMUP00000012353 ENSMMUP00000012353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]