SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012354 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012354
Domain Number 1 Region: 118-177
Classification Level Classification E-value
Superfamily BPTI-like 4.68e-22
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000729
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012354   Gene: ENSMMUG00000009448   Transcript: ENSMMUT00000013183
Sequence length 251
Comment pep:known chromosome:MMUL_1:12:51116985:51154901:-1 gene:ENSMMUG00000009448 transcript:ENSMMUT00000013183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYTMKKVHALWVSICLMLNLAPAPLNADSEEDEEYTIITDTELPPLKLMHSFCAFKPDD
GPCKAIMKRFFFNIFTRQCEEFIYGGCGGNQNRFESMEECKKVCTRDNVHRIIQTALQQE
KPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNMNNFETLEECKNTCEDGLN
GFQVDNYGTQLNAVNNSQTPQSTKVPSFFVTKEGTNDGWKNAAHIYQVFLNAFCIHASMF
FLGLDSILCLC
Download sequence
Identical sequences F6X1B0
ENSMMUP00000012354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]