SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012409 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012409
Domain Number 1 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 2-72
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.07e-21
Family SCAN domain 0.0002
Further Details:      
 
Domain Number 3 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 601-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 668-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-16
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 292-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000127
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 422-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000759
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012409
Domain Number - Region: 377-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0143
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012409   Gene: ENSMMUG00000009484   Transcript: ENSMMUT00000013239
Sequence length 725
Comment pep:known_by_projection chromosome:MMUL_1:20:3222250:3226225:-1 gene:ENSMMUG00000009484 transcript:ENSMMUT00000013239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRASLSRLRELCGHWLRPALHTKKQILELLVLEQFLSVLPPHLLGRLQGQPLRDGEEV
VLLLEGIHREPSHTGPLDFSCNAGKSCPRADVTLEEKGCASQVPSHSPKKELPAEEPSVL
GPSDEPPPLQPRPAKPAELGHWRLPPSSKQPLSPGPQKTFQALQESSPQGPSPWPEESSG
DQELAAVLESLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTAILAESQTD
SPGVPGEPCVQTLGRGAAASGPGGDGSLLGGSEILEVKVAEGVPEPNPELQFICADCGVS
FPQLSRLKAHQLHSHPAGRSFLCLCCGKSFGRSSILKLHMRTHTDERPHACHLCGHRFRQ
SSHLSKHLLTHSSEPAFLCAECGRGFQRRASLVQHLLAHAQDQKPPCAPESKAEAPPLTE
VLCSHCGQTFQRRSSLKRHLRIHARDKDHRSSEGSGSRRRDSDRRPFVCSDCGKAFRRSE
HLVAHRRVHTGERPFSCQACGRSFTQSSQLVSHQRVHTGEKPYACPQCGKRFVRRASLAR
HLLTHGGPRPHLCTQCGKSFGQTQDLARHQRSHTGEKPCRCSECGEGFSQSAHLARHQRI
HTGEKPHACDTCGHRFRNSSNLARHRRSHTGERPYSCHMCGRSFRRNAHLRRHLATHVEP
GQEQAEPPQECVECGKSFSRSCNLLRHLLVHTGARPYSCTQCGRSFSRNSHLLRHLRTHA
RETLY
Download sequence
Identical sequences ENSMMUP00000032693 9544.ENSMMUP00000012409 ENSMMUP00000012409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]