SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012439 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000012439
Domain Number - Region: 57-139
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0759
Family Eukaryotic type KH-domain (KH-domain type I) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012439   Gene: ENSMMUG00000009513   Transcript: ENSMMUT00000013273
Sequence length 487
Comment pep:known chromosome:MMUL_1:7:87296239:87307068:1 gene:ENSMMUG00000009513 transcript:ENSMMUT00000013273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSGGDPPAQEWFMVQTKSKPRVQRQRLQVQRIFRVKLNAFQSRPDTPYFWLQLEGPRE
NMGKAKEYLKGLCNPELWKEVRYPPILHCAFLGAQGLFLDCLCWSTLAYLVPGPPGSLMV
GGLTESFIMTQNWLEELVGRLRWGPAPLLTPRGIWEAEVTRAFGALVWIRGDQHAGDLLQ
LPPAVQELLLSLVRDAAGKEDIIEWLSRFGISDSHSDPEVLICPSQQQKEAPAMVSVGES
PGPFVDMGTLQNRVPENSKRLSSLGATGSLIPAQSTPQETATQLVRVGSNSQGGMDSAQE
EGPVQATSSQDSTNHTQALLKQKQVQRIEDKLLFQPPVSALGVCPSWKAWTPGPAFGPLW
PGAIAATFWRINELHSLHLAWLLSQACFNFPFWQRPLGPIQLKLPGQNPLPLNLEWKQKE
LAPLPSAESPAGRPDGGLGGEAALQNCPRPEIPPKVTSLLVVPGSSDVKDKVSSDLPQIG
PPLTSTP
Download sequence
Identical sequences 9544.ENSMMUP00000012439 ENSMMUP00000012439 ENSMMUP00000012439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]