SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012499 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012499
Domain Number 1 Region: 646-702
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000126
Family SAM (sterile alpha motif) domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012499
Domain Number - Region: 341-374
Classification Level Classification E-value
Superfamily WWE domain 0.00811
Family WWE domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012499   Gene: ENSMMUG00000009561   Transcript: ENSMMUT00000013341
Sequence length 1000
Comment pep:known_by_projection chromosome:MMUL_1:9:119520759:119570209:1 gene:ENSMMUG00000009561 transcript:ENSMMUT00000013341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERKPNGGSGGVSTSSSGTNLLFSSSATEFSFNVPFIPVTQASASPASLLLPGEDSTDV
GEEDSFLGQTSIHTSAPQTVSYFSQVSSSSDPFGNIVQSPLTTAATSGGQSGFPKPPTAL
PFTTGSQDVSNAFSPSISKAQPGAPPSSLMGINSYLPSQPSSLPPSHFGNPPQGIPQPGY
NPYRHTPGSSRANPYIAPPQLQQCQTPGPPAHPPPSGPPVQMYQMPPGSLPPVPPSVQSP
AQQQVPARPGAPSVQVPPPFLLQNQYEPVQPHWFYCKEVEYKQLWMPFSVFDSLNLEEIY
NSVQPDPESVVLGTDGGRYDVYLYDRIRKAAYWEEEPAEVRRCTWFYKGDTDSRFIPYTE
EFSEKLEAEYKKAVTTNQWHRRLEFPSGETIVMHNPKVIVQFQPSSVPDEWGTTQDGQTR
PRVVKRGIDDNLDEIPDGEMPQVDHLVFVVHGIGPVCDLRFRSIIECVDDFRVVSLKLLQ
THFKKSLDDGKISRVEFLPVHWHSSLGGDATGVDRNIKKITLPSIGRFRHFTNETLLDIL
FYNSPTYCQTIVEKVGMEINRLHALFMSRNPDFKGGVSVAGHSLGSLILFDILSNQKDLN
LSKCPGPLAVANGVVKQLHFQEKQLPEEPKLTMDESCDLDVENEEVLTLQETLEALSLSE
YFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVEHKAAKLKKAASEKKAVAAT
STKGQEQSTQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAGQVSVAYNSLD
FEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLD
LKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQE
ELEKVANQIKEEEEKQVVEAEKVVESPDFSKDEDYLGKVGMLNGGRRIDYVLQEKPIESF
NEYLFALQSHLCYWESEDTALLLLKEIYRTMNISPEQPQH
Download sequence
Identical sequences F7ELL6
ENSMMUP00000012499 9544.ENSMMUP00000012499 XP_001100615.1.72884 ENSMMUP00000012499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]