SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012510 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012510
Domain Number 1 Region: 349-454
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.28e-34
Family Calponin-homology domain, CH-domain 0.0000107
Further Details:      
 
Domain Number 2 Region: 470-586
Classification Level Classification E-value
Superfamily Spectrin repeat 9.42e-25
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 3 Region: 812-942
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000576
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 751-840
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000353
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 5 Region: 910-1023
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000038
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012510   Gene: ENSMMUG00000032186   Transcript: ENSMMUT00000013353
Sequence length 1062
Comment pep:novel chromosome:MMUL_1:1:42139957:42179967:1 gene:ENSMMUG00000032186 transcript:ENSMMUT00000013353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSLGCFKEPKESIAVPEKAPISPKKRVRFKRRWRGKKIPTPEASHQEETSEGTEVIEE
TETLTKLTVSLQKEDGVGGVKHTPPDILLPRDSAPNSQVVDQGMIVQVKERFQGEVQTAH
LLLENESSVAGGVWDSLEEGMTVIAHLLDNPAERNCEKSVSQLVEFPRTASCSSRAVLLP
LQGETAVEKGNIQLGFRSYASLRTDCPTDTGNQEQFSEGWSAEEGTKSVSDAPQTGSWIA
ECSVSSSLLDKPGGQRCTEPSHVGRVPLQDSRLLTSQSDLSISGVTVSILPSSSGYGSDG
PHIHGIQPKDTEPEKSSTSFSEEDGTLSLEASHTLSWGLEEISDIYISGESGDMSAKEKL
LLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRENLEQAFE
VAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISATEVDSRWQEYQ
SRVDSLIPWIKQHTILMSDKTFPQNPVELKALYNQYIHFKETEILAKEREKGRIEELYKL
LEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLRPAVERLELLLQIANKIQNGA
LNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQECEGLIRQLQVDLQILRDENYY
QLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPPSTLTTTHLKAEPLTKAPYSS
STSWFRKPMTRAELVAISSSEDEGNLRFVYELLSWVEEMQMKLERAEWGNDLPSVELQLE
TQQHIHTSVEELGSSVKEARLYEGKMSQNFRTSYAETLGKLETQYCKLKETSSFRMRHLQ
SLHKFVSRATAELIWLNEKEEEELAYDWSDNNSNISAKRNYFSELTMELEEKQDVFRSLQ
DTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHVKENTAYFQFFSDARELES
FLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMVGDEKEQLIQSKSSVASLVGRSKTIVQL
KPRSPDHLLKSTISVKAICDYRQIEGRTILSEGDGPLAPATC
Download sequence
Identical sequences F6X585
ENSMMUP00000012510 9544.ENSMMUP00000012510 ENSMMUP00000012510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]