SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012634 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012634
Domain Number 1 Region: 146-734
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 8.12e-195
Family Myeloperoxidase-like 0.0000000000845
Further Details:      
 
Domain Number 2 Region: 741-797
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000347
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 790-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000024
Family EGF-like domain of nidogen-1 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012634   Gene: ENSMMUG00000009662   Transcript: ENSMMUT00000013485
Sequence length 839
Comment pep:known_by_projection chromosome:MMUL_1:13:1370175:1451716:1 gene:ENSMMUG00000009662 transcript:ENSMMUT00000013485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWAVLAVTLIMACTEAFFPFISRGKELLWGKPEESRVAGVLEESKRLVDTAMYATMQR
NLKKREILSPHQLLSFSKLPEPTSGEIARAAEIMETSIQAMKRKVNLKIQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRLITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPSILHNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFRGGADCQVTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG
RAYLPFAPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA
LKALNAHWSADAVYQEARKVVGALHQIITLRDYVPRILGPEAFQQYVGPYEGYDSAANPT
VSNVFSTAAFRFGHATIHPLVRRLDAGFQEHPGLPGLWLHETFFSPWTLLHGGGLDPLIR
GLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQ
MKALRDGDWFWWENSHVFTDAQRHELEKHSLSRVICDNTGLTRVPVDAFRVGKFPEDFES
CDSIPGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGHEQL
TCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGGDGRTCV
Download sequence
Identical sequences ENSMMUP00000012634 9544.ENSMMUP00000012634 ENSMMUP00000012634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]