SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012713 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012713
Domain Number 1 Region: 15-112
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.03e-24
Family Haloperoxidase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012713   Gene: ENSMMUG00000031008   Transcript: ENSMMUT00000013567
Sequence length 129
Comment pep:novel chromosome:MMUL_1:10:86524067:86525849:1 gene:ENSMMUG00000031008 transcript:ENSMMUT00000013567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENAAPGLISELKLAVPWGHIAAKAWGSLQGPPVLCLHGWLDNANSFDRLIPLLPQDFY
YVAMDFGGHGLSSHYSSGVPYYHQTFVSEIRRVVAALKWNRFSILGHSFGEYTDQQLTGP
GVGLGGKDR
Download sequence
Identical sequences 9544.ENSMMUP00000012713 ENSMMUP00000012713 ENSMMUP00000012713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]