SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012820 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012820
Domain Number 1 Region: 705-809
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-24
Family Cadherin 0.0041
Further Details:      
 
Domain Number 2 Region: 610-717
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 497-613
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 4 Region: 812-918
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 920-1027
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 6 Region: 141-257
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-18
Family Cadherin 0.0031
Further Details:      
 
Domain Number 7 Region: 1132-1249
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-16
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 1032-1144
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000157
Family Cadherin 0.0015
Further Details:      
 
Domain Number 9 Region: 389-509
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000186
Family Cadherin 0.0061
Further Details:      
 
Domain Number 10 Region: 289-387
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000013
Family Cadherin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012820   Gene: ENSMMUG00000009794   Transcript: ENSMMUT00000013680
Sequence length 1953
Comment pep:known_by_projection chromosome:MMUL_1:9:82647036:83507320:1 gene:ENSMMUG00000009794 transcript:ENSMMUT00000013680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRQFYLWTCLASGIILGSLVKICLGQYDDDCKLARGGPPATIVAIDEESRNGTILVDNM
LIKGTAGGRDPTIELSLKDNMDYWVLMDPVKQMLFLNSTGRVLDRDPPMNIHSIVVQVQC
VNKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTPVGTTIFTGFSGDNGATDID
DGPNGQIEYVIQYNPDDPTSNDTFEIPLMLTGNVVLRKRLNYEDKTRYFVIIQANDRAQN
LNERRTTTTTLTVDVLDGDDLGPMFLPCVLVPNTRDCRPLTYQAAIPELRTPEELNPIVV
TPPIQAIDQDRNIQPPSDRPGILYSILVGTPEDYPRFFHMHPRTAELSLLEPVNRDFHQK
FDLVIKAEQDNGHPLPAFASLHIEILDENNQSPYFTMPSYQGYIPESAPVGATIADSLNL
TSPLRIVALDKDIEDTKDPELHLFLNDYTSVFTVTQTGITRYLTLLQPVDREEQQTYTFS
ITAFDGVQESEPVIVNIQVMDANDNTPTFPEISYDVYVYTDMRPGDSVIQLTAVDADEGS
NGEITYEILVGAQGDFIINKTTGLITIAPGVEMIVGRTYALTVQAADNAPPAERRHSICT
VYIEVLPPNNQSPPRFPQLMYSLEISEAMRVGAVLLNLQATDREGDPITYAIENGDPQRV
FNLSETTGILTLGKALDRESTDRYILIITASDGRPDGTSTATVNVVVTDVNDNAPVFDPY
LPRNLSVVEEEANAFVGQVKATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAVKLNRE
VRDYYELVVVATDGAVHPRHSTVTLAIKVLDIDDNSPVFTNSTYTVLVEENLPAGTTILQ
IEAKDVDLGANVSYRIRSPEVKHFFALHPFTGELSLLRSLDYEAFPDQEASITFLVEAFD
IYGTMPPGIATVTVIVKDMNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADPPGLPA
SRVRYRVDDVQFPYPASIFDVEEDSGRVITRVNLNEEPTTIFKLVVVAFDDGEPVMSSSA
TVKILVLHPGEIPRFTQEEYRPPPVSELATKGTMVGVISAAAINQSIVYSIVSGNEEDTF
GINNITGVIYVNGPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDENNH
PPVFQKKFYIGGVSEDARMFTSVLRVKATDKDTGNYSVMAYRLIIPPIKEGKEGFVVETY
TGLIKTAMLFHNMRRSYFKFQVIATDDYGKGLSGKADVLVSVVNQLDMQVIVSNVPPTLV
EKKIEDLTEILDRYVQDQIPGAKVVVESIGARRHGDAFSLEDYTKCDLTVYAIDPQTNRA
IDRNELFKFLDGKLLDINKDFQPYYGEGGRILEIRTPEAVTSIKKRGESLGYTEGALLAL
AFIIILCCIPAILVVLVSYRHLALRQAECTKTARIQAALPAAKPAAPAPAPVAAPPPPPP
PPPGAHLYEELGDSSILFLLYHFQQSRGNHSVSEDSKHQQVVMPFSSNTIEAHKAAHVDG
SLKSNKPKSARTFTFLSDEDALSAHNPLYRENISQVSTNSDISLRTDFVDPFLPKIQAKS
KSLRGPREKIQRLWSQSVSLPRRLMRKVPNRPEIIDLQQWQGTRQKAENENTGICTNKRG
SSNPLLTTEEANLTEKEEIRQGETLIIKGTEQLKSLSSDSSFCFPRPHFSFSTLPTVSRT
VELKSEPNVITSPAECSLELSPSRPCVLNSSLSRRETPICMLTVETERNIFENFAHPPNI
SPSACPPPPPPISPPSPPPAPAPLAPPPDISPFSLFCPPPSPPSIPLPLPPSTFFPLSIS
TSGPPTPPLLPPFPTLPPPPPSIPCPPPPSASFLSTECVCITGVKCTTNMMPAEEIKSSM
TQLSATTVCKTDPRREPKGILKHVKNLAELEKSVANMYSQIEKNYLRTNVSELQTMCPSE
VTNMEITSEPNKENLNNIVEETEKQSHSQSTSL
Download sequence
Identical sequences 9544.ENSMMUP00000012820 ENSMMUP00000012820 ENSMMUP00000012820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]