SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012873 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012873
Domain Number 1 Region: 159-347
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000365
Further Details:      
 
Domain Number 2 Region: 511-612
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-26
Family SH2 domain 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012873   Gene: ENSMMUG00000009833   Transcript: ENSMMUT00000013738
Sequence length 630
Comment pep:known chromosome:MMUL_1:7:27146775:27287736:-1 gene:ENSMMUG00000009833 transcript:ENSMMUT00000013738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRERSQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPH
PALAPHLPAEDAALPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESRDPGSSSPSSPETSLSRSGTAPPPQPDLVSHRATALTPDSCPLPGPGEPPLRSRQDRH
FLQHLLGMGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECHNGMAQDVINTIGQAFELRFKQYLKNPSLDTSCESEEV
RIDSHAEESEDHEYYNEIPGKQPPAGGVSDMRIKVQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTLGSAGN
QSSAQPLGSPWHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPALLHSNK
Download sequence
Identical sequences A0A2K6CJ02 F7A7H5 G7PBA3
9544.ENSMMUP00000012873 ENSMMUP00000012873 XP_001113330.1.72884 XP_005559556.1.63531 XP_011754833.1.29376 ENSMMUP00000012873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]