SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012893 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012893
Domain Number 1 Region: 57-320
Classification Level Classification E-value
Superfamily Caspase-like 4.34e-81
Family Caspase catalytic domain 0.0000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012893   Gene: ENSMMUG00000009850   Transcript: ENSMMUT00000013759
Sequence length 321
Comment pep:known chromosome:MMUL_1:14:103518797:103544824:-1 gene:ENSMMUG00000009850 transcript:ENSMMUT00000013759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSIQEKQRMAGQMLLQTFFNIDQISPSKKAHLNMEARPPESGESADALKLCPHEEFLR
LCKERAEEIYPIKERNDRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVE
ENLTAKDMESALRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHDEKNPDVLLYDTVFQ
IFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSPENLEEDAVYKTHV
EKDFIAFCSSTPHNVSWRDSTMGSVFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAK
AQMPTIERLSMTRYFYLFPGN
Download sequence
Identical sequences ENSMMUP00000012893 ENSMMUP00000012893 9544.ENSMMUP00000012893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]