SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012999 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012999
Domain Number 1 Region: 8-219,325-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.06e-49
Family FAD-linked reductases, N-terminal domain 0.000075
Further Details:      
 
Domain Number 2 Region: 222-325
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.45e-25
Family D-aminoacid oxidase-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012999   Gene: ENSMMUG00000009937   Transcript: ENSMMUT00000013875
Sequence length 390
Comment pep:known chromosome:MMUL_1:16:24261878:24276148:1 gene:ENSMMUG00000009937 transcript:ENSMMUT00000013875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRVLLLEQFFLPHSRGSSHGQSRIIRKAYL
EDFYTQMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQASLSRQRVEHQCL
SSEELKQRFPNIRLTRGEVGLLDNSGGVLYAYKALRALQDAVRQLGGIVHDGEKVVEINP
GLLVKVKTTTRSYQAKSLVITAGPWTNQLLRPLGIELPLQTLRINVCYWRERVPGSYGVS
QAFPCFLWLGLYPHHLYGLPAGEYPGLMKVSYHHGNHADPEERDCPTARADIRDVQIVSS
FVRDHFPDLKPEPAVMESCMYTNTPDEHFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLTPSYDLAPFRISRFPSLGKAHL
Download sequence
Identical sequences F6XXQ3 G8F5H8
ENSMMUP00000012999 XP_005583338.1.63531 XP_014974428.1.72884 9544.ENSMMUP00000012999 ENSMMUP00000012999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]