SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013085 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013085
Domain Number 1 Region: 116-334
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000265
Family Leucine rich effector protein YopM 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013085   Gene: ENSMMUG00000010007   Transcript: ENSMMUT00000013971
Sequence length 375
Comment pep:known chromosome:MMUL_1:6:137033326:137034992:-1 gene:ENSMMUG00000010007 transcript:ENSMMUT00000013971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPHPDWSEAFQCVSAVEVEIR
VGGLSLEPFLTRVDPDADPRQYADTIKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLQE
LTLEDLEITGTMPPLPLEATGLALSSLRLHNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLIAALCPHKFPALQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATANPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRRPRPDELPQVDNLALDGNPFLVPGTALPQEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
Download sequence
Identical sequences B3Y6B7 B3Y6B8
ENSMMUP00000013085 9544.ENSMMUP00000013085 NP_001123905.1.72884 XP_005558045.1.63531 ENSMMUP00000013085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]