SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013117 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013117
Domain Number 1 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 161-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 105-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.77e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 441-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.75e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 67-119
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000993
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013117   Gene: ENSMMUG00000010035   Transcript: ENSMMUT00000014008
Sequence length 510
Comment pep:known chromosome:MMUL_1:3:60194315:60225283:-1 gene:ENSMMUG00000010035 transcript:ENSMMUT00000014008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSHFTQDVWPEQSIKDSFQKVILRTCGKYGHENLQLRKDHKSVDACKVYKGGYNGLNQC
LTTTESKIFQCDKYVKVFHKFSNVNRSKIRHTGKKPFKCKNRGKSFCMLSQLTQHKKIHT
REYSYKCEECGKAFNWSSTLTKHKIIHTGEKPYKCEECGKAFNRSSNLTKHKIIHTGEKP
YKCEECGKAFNRSSTLTKHKRIHTEEKPYKCEECGKAFNQFSILNKHKRIHMEDKPYKCE
ECGKAFRVFSILKKHKIIHTGEKPFKCEECGKAFNQFSNLTKHKIIHTGEKPYKCDECGK
AFNQSSTLTKHKRIHTGEKPYKCEECGKAFKQSSTLTEHKIIHTGEKPYKCEECGKAFSW
SSAFTKHKRNHMEDKPYKCEECGKAFSVFSTLTKHKIIHTREKPYKCEECGKAFNQSSIF
TKHKINHTEGKSYKCEKCGNAFNQSSNLTAHKIVYTGEKPYKYEECDKAFNNFSTLITHQ
IIYTGEKPYKHECGRAFNKSSNYTKEKLQT
Download sequence
Identical sequences ENSMMUP00000013117 XP_014988892.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]