SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013132 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013132
Domain Number 1 Region: 441-695
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-51
Family YWTD domain 0.00000363
Further Details:      
 
Domain Number 2 Region: 4-258
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-36
Family YWTD domain 0.0000686
Further Details:      
 
Domain Number 3 Region: 359-450,691-742
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000251
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 932-976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000282
Family EGF-type module 0.00022
Further Details:      
 
Domain Number 5 Region: 311-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000197
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 791-909
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 7 Region: 280-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000464
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013132   Gene: ENSMMUG00000010043   Transcript: ENSMMUT00000014023
Sequence length 1166
Comment pep:known_by_projection chromosome:MMUL_1:5:102840559:102913666:1 gene:ENSMMUG00000010043 transcript:ENSMMUT00000014023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPAPFLIFSHGNSIFRIDTEGTNYEPLVVDAGVSVIMDFHYKEKTIYWVDLERQLLQRVF
LNGSRQERVCNIEKNVSGMAINWINEEVIWSNQQEGIITVTDMKGNNSHVLLSALKYPAN
IAVDPVERFIFWSSEVAGSLYRADLDGVEVKSLLETSEKITAVSLDVLDKRLFWIQYSRE
GSNSLICSCDYDGGSVHVSKHPTQHNLFAMSLFGDHVFYSTWKTRTIWIANKHTGKDMVR
INLHPSFVPPGELKVVHPLAQPKAEDDARECEQKLHKLRKGNCSSTVCGQDAQSHLCTCA
EGYALSRDRKYCEDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCP
SNVSECSHDCVLTSEGPLCFCPEGSVLERDGKTCSGCSSPDNGGCSQLCIPLSPVSWECD
CFPGYDLQLDKKSCVASGPQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPV
ENKIYFAHTALKWIERANMDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRS
DLNGKHPKIIIKENISQPRGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLI
WPNGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRTLTQNDVGHPFAIAVFEDYVWFSDW
AMPSVIRVNKKTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKERLGT
AWCLCREGFMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDTLSKTRVSEDNITESQHM
LVAEITVSDQYDCAPVGCSTYARCVSEGKDVTCQCLKGFAGDGILCSDIDECEMGVPVCP
PASSKCINTEGGYVCQCSEGYRGDGIHCLDIDECQLGVHSCGENANCTNTEGGYTCTCAG
RLSEPGLICPDSTPPPHLREDGHHYSVRNSDSGCPLSHDGYCLHDGVCMYIEALDKYACN
CVVGYIGERCQYRDLKWWELRHAGHGQQQKVTVVAVCVVVLVVLLLLSLWGAHYYRTQKL
LTKNPKNPSEESSRDARSHRPADSEDGMSSCPQPWFVVTKEHQDLRNGSQPVAGEDGQAA
DVGSVQPTSWRQKPQLCGVGPEQGCWIPVSSDKGSCPQVMERSFHMPSYGTRPVDGGVQK
PHSLLSVNTLWQQRALDPPHQMELTQ
Download sequence
Identical sequences ENSMMUP00000013132 ENSMMUP00000013132 9544.ENSMMUP00000013132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]