SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013244 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013244
Domain Number 1 Region: 188-627
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.68e-71
Family Tandem AAA-ATPase domain 0.02
Further Details:      
 
Domain Number 2 Region: 807-879
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000000353
Family AN1-like Zinc finger 0.0027
Further Details:      
 
Domain Number 3 Region: 730-764
Classification Level Classification E-value
Superfamily R3H domain 0.00000255
Family R3H domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013244   Gene: ENSMMUG00000010128   Transcript: ENSMMUT00000014141
Sequence length 921
Comment pep:known_by_projection chromosome:MMUL_1:14:5798087:5833965:-1 gene:ENSMMUG00000010128 transcript:ENSMMUT00000014141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAAVESFVTKQLDLLELERDAEVEERRSWQENISLKELQSRGVCLLKLQVSSQRTGLY
GRLLVTFEPRRCGSVAALPSNSFTSGDIVGLYDAANEGSQLATGILTRVTQKSVTVAFDE
SHDFQLSLDRENSYRLLKLANDVTYRRLKKTLIALKKYHSGPASSLIEVLFGRSAPSSAS
EIHPLTFFNTSLDASQKEAVSFALSQKELAIIHGPPGTGKTTTVVEIILQAVKQGLKVLC
CAPSNIAVDNLVERLALCKQRILRLGHPARLLESIQQHSLDAVVARSDSAQIVADIRKDI
DQVFVKNKKTQDKREKSNFRNEVKLLRKELKGREEAAILESLTSANVVLATNTGASADGP
LKLLPESHFDVVVIDECAQALEASCWIPLLKARKCILAGDHKQLPPTVVSHKAALAGLSL
SLMERLAEEYGARAVRTLTVQYRMHQAIMRWASDTMYHGQLTAHPSVAGHLLRDLPGVAA
TEETGVPLLLVDTASCGLFELEEEDEQSKGNPGEVRLVSLHIQALVDAGVPARDVAVVSP
YNLQVDLLRQSLAHRHPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVA
VTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHESSQGPS
HAATKPQGPATSTRTGSQRQEGGRESAAAARQGRKKPAGKSLAAEAPSQPSLNRGSLEGV
ESQDGVDHFRATIAEFMASDKTQLEFPPSLNSHDRLRVHQIAEELQRVRSAQGQPASKEQ
QASGQQKLPDKKKKKETKGHPAIDLPTEEDFEALVSAAIKADNTCGFAKCTASVTALGQF
CQLCSRRYCLSHHLPEIHGCGERARAHARQRISREGILYAGSGTKDRSLDPAKRAQLQRR
LDKKLSELSNQRTSRRKERGT
Download sequence
Identical sequences ENSMMUP00000013244 9544.ENSMMUP00000013244 ENSMMUP00000013244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]