SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013262 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013262
Domain Number 1 Region: 221-444
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.53e-85
Family Fibrinogen C-terminal domain-like 0.00000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013262   Gene: ENSMMUG00000010139   Transcript: ENSMMUT00000014160
Sequence length 444
Comment pep:known chromosome:MMUL_1:8:6563967:6623377:-1 gene:ENSMMUG00000010139 transcript:ENSMMUT00000014160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKVLNQTTRLELQLLEHSLSTNKLEK
QILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEK
KIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGH
TTNGVYTLTLPNSTEEVKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGE
YWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGK
ISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGI
KWYYWKGSGYSLKGTTMMIRPADF
Download sequence
Identical sequences A0A2K5VNT5 F6QXG0
ENSMMUP00000013262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]