SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013335 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013335
Domain Number 1 Region: 99-199
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-31
Family SH2 domain 0.0000764
Further Details:      
 
Domain Number 2 Region: 44-95
Classification Level Classification E-value
Superfamily SH3-domain 0.00000149
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013335   Gene: ENSMMUG00000010197   Transcript: ENSMMUT00000014237
Sequence length 293
Comment pep:known chromosome:MMUL_1:8:135602248:135666603:-1 gene:ENSMMUG00000010197 transcript:ENSMMUT00000014237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHRLWASPAAPGKKKEMGNSMKSAPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIF
RRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDT
KVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEV
ADGLCCVLTTPCLTQSTAAPAVRASNSPVTLRQKTVDWRRMSRLHENPEGTENPLGVDES
LFSYGLRESIASYLSLTSEDNTSFDRKKKSVSLMYSGSKRKSSFFSSPPYFED
Download sequence
Identical sequences A0A2I3MLI0 A0A2K5W9V9 A0A2K6CJB8 F6SJ90
9544.ENSMMUP00000013335 ENSMMUP00000013335 ENSMMUP00000013335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]