SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013441 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000013441
Domain Number - Region: 129-180
Classification Level Classification E-value
Superfamily L domain-like 0.000646
Family Internalin LRR domain 0.045
Further Details:      
 
Domain Number - Region: 215-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00644
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013441   Gene: ENSMMUG00000010263   Transcript: ENSMMUT00000014351
Sequence length 284
Comment pep:known_by_projection chromosome:MMUL_1:13:27178672:27183820:1 gene:ENSMMUG00000010263 transcript:ENSMMUT00000014351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTSAEFREQEKPPASPRANGPGRLGHARGRGPDALRGGAAGPGRVSTGELRERKMASHG
PGSLTTLVRWAAALLLALGVERALALPEICTQCPGSVQNLSKVALYCKTTRELMLHARCC
LNQKGTILGLDLQNCSLEDPGPNFHQAYTTVIIDLQANPLKGDLANTFHGFTQLQTLILP
QDVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGNPEMCPENGSCVPDGPGLLQCVCAD
GFHGYKCMRQGSFSLLMFFGILGSTTLSISILLWGTQRRKAKTS
Download sequence
Identical sequences F6PVQ8
ENSMMUP00000013441 9544.ENSMMUP00000013441 ENSMMUP00000013441 NP_001180855.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]