SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013449 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013449
Domain Number 1 Region: 105-194
Classification Level Classification E-value
Superfamily WWE domain 1.31e-29
Family WWE domain 0.00093
Further Details:      
 
Domain Number 2 Region: 31-116
Classification Level Classification E-value
Superfamily WWE domain 3.53e-25
Family WWE domain 0.00068
Further Details:      
 
Domain Number 3 Region: 415-518
Classification Level Classification E-value
Superfamily RING/U-box 1.12e-19
Family RING finger domain, C3HC4 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013449   Gene: ENSMMUG00000010277   Transcript: ENSMMUT00000014359
Sequence length 645
Comment pep:known_by_projection chromosome:MMUL_1:14:14599370:14635767:-1 gene:ENSMMUG00000010277 transcript:ENSMMUT00000014359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGRGPEAAAQEEAEEVGRSGRSPGLAMLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVV
RAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWE
WENDNGSWTPYDMEVGITIQHAYEKQHPWIDLTSIGFSYVIDFNTMGQINRQTQRQRRVR
RRLDLIYPMVTGTLPKAQSWPVSSGPATSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQP
PVTRKNLPPPGVVRLPPPPGSGAKPLDSTGTIRGPVKTAPSQVIRRQASSVPTGTTVGSP
ASPPGPNGKTGRVALATLNRSNLQRLAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGI
TGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVL
KKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHIYHIYCLVAMYN
NGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGP
EHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWN
EVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD
Download sequence
Identical sequences 9544.ENSMMUP00000013449 ENSMMUP00000013449 ENSMMUP00000013449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]