SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013531 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013531
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000112
Family Thioltransferase 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013531   Gene: ENSMMUG00000010325   Transcript: ENSMMUT00000014443
Sequence length 108
Comment pep:novel chromosome:MMUL_1:15:25865317:25879539:1 gene:ENSMMUG00000010325 transcript:ENSMMUT00000014443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQIINDMNEFKTFLTAAGHKLAVVEFSSKWCGPCKRMVPVFHELAETCHIKTIPTFQMF
KKSQKGSISRPSPTSELHPHQKWTLDSSQANPSQTRANFRTLLKQLGK
Download sequence
Identical sequences A0A1D5RDS7 A0A2I3LX59 A0A2K6CZ03 G7PRP8
ENSMMUP00000013531 9544.ENSMMUP00000013531 XP_005581155.1.63531 XP_011738639.1.29376 XP_014972607.1.72884 ENSMMUP00000013531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]