SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013533 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013533
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.05e-23
Family Thioltransferase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013533   Gene: ENSMMUG00000010325   Transcript: ENSMMUT00000014446
Sequence length 86
Comment pep:novel chromosome:MMUL_1:15:25865317:25877582:1 gene:ENSMMUG00000010325 transcript:ENSMMUT00000014446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQIINDMNEFKTFLTAAGHKLAVVEFSSKWCGPCKRMVPVFHAMSVKYQNVFFANVDVN
NSPELAETCHIKTIPTFQMFKKSQKV
Download sequence
Identical sequences ENSMMUP00000013533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]