SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013535 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013535
Domain Number 1 Region: 182-315
Classification Level Classification E-value
Superfamily PH domain-like 5.28e-40
Family Pleckstrin-homology domain (PH domain) 0.000000858
Further Details:      
 
Domain Number 2 Region: 21-81
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.44e-22
Family Adapter protein APS, dimerisation domain 0.0000182
Further Details:      
 
Domain Number 3 Region: 418-526
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-21
Family SH2 domain 0.00000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013535   Gene: ENSMMUG00000010329   Transcript: ENSMMUT00000014448
Sequence length 639
Comment pep:known chromosome:MMUL_1:3:49610362:49633040:1 gene:ENSMMUG00000010329 transcript:ENSMMUT00000014448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGAAPGPATAAPVPVPVPVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDAGAS
FSRHFAANFLDVFGEEVRRVLVAGPTTRGAAVRAEAMEPEPADTSALKAAPYGHSRSSED
VSTHAATKARVRKGFSLRNMSLCVVDGVRDMWHRRSSPEPDAGASPRAAEPSAEPRDKWT
RRLRLSRTLAAKVELVDIQREGALRFMVADDAAAGSGGSAQWQKCRLLLRRAVAEERFRL
EFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHS
WVADIQGCVDPGDSEEDTELSCTRGGCLASRVASCSCELLTDAVDLPRPPETTATGAVVT
APHSRGRDAVRESLIHVPLETFLQTLESPGGSGSDSNNTGEEGAETEPEAEPELELSDYP
WFHGTLSRVKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKASHLRLSLNGH
GQCHVQHLWFQSVLDMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPEPGPAPPATPAP
PACWSDPPGQHYFSSLAAAACPPASPSDAAGASSSSASSSSAASGPAPTRPVEGPLSVRS
RSNSAERLLEAVAAAAAAEEPQEAAPGRARAVENQYSFY
Download sequence
Identical sequences 9544.ENSMMUP00000013535 ENSMMUP00000013535 ENSMMUP00000013535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]