SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013622 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013622
Domain Number 1 Region: 157-268
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-26
Family Cadherin 0.0000185
Further Details:      
 
Domain Number 2 Region: 270-382
Classification Level Classification E-value
Superfamily Cadherin-like 6e-24
Family Cadherin 0.0000212
Further Details:      
 
Domain Number 3 Region: 377-504
Classification Level Classification E-value
Superfamily Cadherin-like 6.54e-24
Family Cadherin 0.00031
Further Details:      
 
Domain Number 4 Region: 57-155
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000242
Family Cadherin 0.0000314
Further Details:      
 
Domain Number 5 Region: 490-592
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000377
Family Cadherin 0.0000627
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013622   Gene: ENSMMUG00000010393   Transcript: ENSMMUT00000014540
Sequence length 777
Comment pep:known chromosome:MMUL_1:20:67027215:67052889:1 gene:ENSMMUG00000010393 transcript:ENSMMUT00000014540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFMGCPGQEPALFSTVNDDFTVQNGETVQDRKSLKERNPKIFPSKRILRRHKRDWVVAPI
SVPENGKGPFPQRLNQLKFNKDRDTKIFYSIMGPGADSPPEGVFAVEKETGWLLLNKPLD
REEIAKYEATLFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGT
SVMQVTATDEDDAIHTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVP
EYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPVFDPQKYESHVPENAVGHEVQRLTVT
DLDAPNSPAWRATYLIVGGDDGDHFTIATHPESNQGILTTRKGLDFEAKNQHTLYVEVTN
EAPFVLKLPTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEAVCVYTAKDPDKENQ
KISYRILRDPAGWLAMDPDSGQVTVAGTLDREDERFVRNNIYEVMVLAVDNGSPPTTGTG
TLLLTLIDVNDHGPVPEPREITICNQSPESQVLNITDKDLSPHTSPFQAQLTDDSDIYWM
AEVNEKDDTVVLSLKKFLKQDTYDVHLSLSDHGNKEQLTVIRATVCDCHGHVEKCPDPWK
GGFILPVLGAVLALLLLLLVLLLLVRKKRKVKEPLLLPEDDTRDNVFYYGEEGGGEEDQD
YDITQLHRGLEARPEVVLRNDVAPTFIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAP
PYDSLLVFDYEGSGSDAASLSSLTSSTSDQDQDYDYLNEWGSRFKKLADMYGGGDDD
Download sequence
Identical sequences ENSMMUP00000032349 ENSMMUP00000013622 9544.ENSMMUP00000013622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]