SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013639 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013639
Domain Number 1 Region: 131-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000251
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 2 Region: 89-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013639   Gene: ENSMMUG00000010402   Transcript: ENSMMUT00000014557
Sequence length 406
Comment pep:known_by_projection chromosome:MMUL_1:18:52700974:52955784:-1 gene:ENSMMUG00000010402 transcript:ENSMMUT00000014557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPPPPSRGGAARGQLGRSLGPLLLLLALGHTWTYREEPEDGDREICSESKIATTKYPCL
KPTGELTTCYRKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCTDNFGRVLCTCYPGYRYD
RERHRKREKPYCLDIDECASSNGTLCAHICINTLGSYRCECREGYIQEDDGKTCTKGDKY
PNDTGHEKSENAVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLA
SNAYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQG
RRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHR
THSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
Download sequence
Identical sequences A0A2K5TM47 A0A2K5YB35 F7D3T0
XP_005586610.1.63531 XP_011827078.1.47321 XP_014977601.1.72884 XP_015295185.1.63531 XP_015295187.1.63531 XP_015295188.1.63531 9544.ENSMMUP00000013639 ENSMMUP00000013639 ENSMMUP00000013639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]