SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013672 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013672
Domain Number 1 Region: 89-214,319-417,532-688
Classification Level Classification E-value
Superfamily L domain-like 4.2e-60
Family Ngr ectodomain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 759-896
Classification Level Classification E-value
Superfamily L domain-like 3.17e-34
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 3 Region: 1150-1340
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-31
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 4 Region: 1005-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000326
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 5 Region: 923-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000676
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 6 Region: 1083-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 1044-1081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000676
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 965-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1336-1376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013672
Domain Number - Region: 1380-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000224
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1425-1456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00024
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013672   Gene: ENSMMUG00000010428   Transcript: ENSMMUT00000014594
Sequence length 1535
Comment pep:known_by_projection chromosome:MMUL_1:9:96579797:96762446:-1 gene:ENSMMUG00000010428 transcript:ENSMMUT00000014594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTPGWGSSAGPVRPELWLLLWAAAWSLGASACPALCTCTGTTVDCHGTGLQAIPKNIP
RNTERLELNGNNITRIHKNDFVGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQ
LHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQINCIEEGAFRAL
RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFT
QCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSNGIVDCRGKGL
TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLN
SLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSL
AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCASPRRLSNKRIGQI
KSKKFRCSAKEQYFIPGTEDYQLNSECNSDVICPHKCRCEASVVECSSLKLTKIPERIPQ
STAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQ
LESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTL
QSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCE
EGQEEGGCLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQL
STFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLH
GNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPLDME
GKLLLTTPAKKFECQGPPTLAVQAKCDPCLSSPCQNQGICHNDPLEVYRCACPSGYKGRD
CEVSLDSCSSGPCENGGTCHAQEGKDAPFMCSCPTGFEGPTCGVNTDDCVDHACANGGVC
VDGVGNYTCQCPVQYEGRACEQLVDLCSPDLNPCQHEARCVGTPDGPRCECVPGYAGDNC
SENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPTPKSPCEGTECQNGA
NCVDQGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVIVSQNQ
GRDLVSWGEPAGVSGEVPRQGWSRLTPTPGWGTPSCSSAETINDGQFHTVELVAFDQMVN
LSIDGGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYI
NNELQDFTKTQMKPGVVPGCEPCLKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADG
PCHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASATKG
AHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQ
GLRLKRRKFTFECSDGTSFAEEVEKPTKCGCALCA
Download sequence
Identical sequences ENSMMUP00000013672 9544.ENSMMUP00000013672 ENSMMUP00000010279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]